Rabbit polyclonal anti-MARCH2 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MARCH2. |
Rabbit polyclonal anti-MARCH2 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MARCH2. |
Rabbit Polyclonal Anti-MARCH2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MARCH2 antibody: synthetic peptide directed towards the C terminal of human MARCH2. Synthetic peptide located within the following region: TIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSP |
MARCH2 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human MARCH2 |
MARCH2 Antibody - middle region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |