Antibodies

Jump to Filters
View as table Download
MARCH3 Rabbit Polyclonal Antibody
TA316016

USD 345.00

4 Weeks

Rabbit polyclonal anti-MARCH3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MARCH3.
MARCH3 Rabbit Polyclonal Antibody
TA331562

USD 375.00

5 Days

Rabbit Polyclonal Anti-March3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-March3 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFS