Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-Angiotensin-(1-7) Mas Receptor
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)KIRKNTWASHSSK, corresponding to amino acid residues 212-224 of the rat Angiotensin-(1-7) Mas receptor.3rd intracellular loop. |
Rabbit Polyclonal Anti-MAS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAS1 antibody: synthetic peptide directed towards the middle region of human MAS1. Synthetic peptide located within the following region: VIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIII |
Rabbit Polyclonal MAS1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Anti-MAS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAS1 antibody: synthetic peptide directed towards the middle region of human MAS1. Synthetic peptide located within the following region: RPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAI |
Rabbit Polyclonal Anti-MAS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MAS1 antibody is: synthetic peptide directed towards the N-terminal region of Human MAS1. Synthetic peptide located within the following region: VTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLW |
Active filters
Target Symbol
- MAS1