Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-MAT2B (isoform 1) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence REKELSIHFVPGS-C, from the N Terminus of the protein sequence according to NP_037415.1. |
Rabbit polyclonal Anti-MAT2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAT2B antibody: synthetic peptide directed towards the N terminal of human MAT2B. Synthetic peptide located within the following region: KEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAA |
Rabbit polyclonal Anti-MAT2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAT2B antibody: synthetic peptide directed towards the middle region of human MAT2B. Synthetic peptide located within the following region: GNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGE |
MAT2B rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MAT2B |
MAT2B rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MAT2B |
MAT2B Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-334 of human MAT2B (NP_037415.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- MAT2B