Rabbit Polyclonal VISA Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VISA antibody was raised against a 13 amino acid peptide from near the amino terminus of human VISA. |
Rabbit Polyclonal VISA Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VISA antibody was raised against a 13 amino acid peptide from near the amino terminus of human VISA. |
Rabbit anti-MAVS Polyclonal Antibody
| Applications | ELISA, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MAVS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAVSantibody: synthetic peptide directed towards the C terminal of human VISA. Synthetic peptide located within the following region: VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ |
Rabbit Polyclonal VISA Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VISA antibody was raised against a 17 amino acid peptide from near the center of human VISA. |
Mouse Monoclonal MAVS Antibody (58N3B6)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MAVS Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAVSantibody: synthetic peptide directed towards the N terminal of human VISA. Synthetic peptide located within the following region: ETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGH |
Mouse Monoclonal MAVS Antibody (58N3E1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal MAVS Antibody (58N2B2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAVS mouse monoclonal antibody, clone OTI8A11 (formerly 8A11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAVS mouse monoclonal antibody, clone OTI9C4 (formerly 9C4)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MAVS Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MAVS |
MAVS rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MAVS |
MAVS mouse monoclonal antibody, clone OTI8A11 (formerly 8A11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MAVS mouse monoclonal antibody, clone OTI8A11 (formerly 8A11), Biotinylated
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Biotin |
MAVS mouse monoclonal antibody, clone OTI8A11 (formerly 8A11), HRP conjugated
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
MAVS mouse monoclonal antibody, clone OTI8A11 (formerly 8A11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MAVS mouse monoclonal antibody, clone OTI9C4 (formerly 9C4)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MAVS mouse monoclonal antibody, clone OTI9C4 (formerly 9C4), Biotinylated
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Biotin |
MAVS mouse monoclonal antibody, clone OTI9C4 (formerly 9C4), HRP conjugated
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
MAVS mouse monoclonal antibody, clone OTI9C4 (formerly 9C4)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |