Antibodies

View as table Download

Rabbit Polyclonal MBD4 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MBD4 antibody: human MBD4 (Methyl-CpG-binding domain protein 4), using three different KLH-conjugated synthetic peptides.

Rabbit Polyclonal MBD4 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human MBD4 protein (between residues 200-250) [UniProt O95243]

Rabbit Polyclonal Anti-MBD4 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MBD4 antibody: synthetic peptide directed towards the middle region of human MBD4. Synthetic peptide located within the following region: CSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLHT

Rabbit polyclonal anti-MBD4 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 474 of mouse MBD4

MBD4 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MBD4

MBD4 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MBD4