Rabbit Polyclonal Anti-MBNL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBNL1 antibody: synthetic peptide directed towards the middle region of human MBNL1. Synthetic peptide located within the following region: AMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGI |
Goat Anti-MBNL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SAEHLTSHKYVTQ, from the C Terminus of the protein sequence according to NP_066368.2; NP_997175.1; NP_997176.1; NP_997177.1; NP_997178.1; NP_997179.1; NP_997180.1. |
Rabbit Polyclonal Anti-MBNL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBNL1 antibody: synthetic peptide directed towards the C terminal of human MBNL1. Synthetic peptide located within the following region: LCPQQQHLPQVFPSLQQPQPTSPILDASTLLGATSCPAAAAGKMIPIISA |
MBNL1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-382 of human MBNL1 (NP_066368.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
