Rabbit Polyclonal Anti-Mbnl2 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Mbnl2 antibody is: synthetic peptide directed towards the middle region of RAT Mbnl2. Synthetic peptide located within the following region: IACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAAMLAQQ |
Rabbit Polyclonal Anti-MBNL2
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-MBNL2 antibody: synthetic peptide directed towards the middle region of human MBNL2. Synthetic peptide located within the following region: ENGRVIACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAA |
MBNL2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MBNL2 |
MBNL2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 160-260 of human MBNL2 (NP_659002.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
