Antibodies

Jump to Filters
View as table Download
MCM6 Rabbit Polyclonal Antibody
TA349393

USD 380.00

In Stock

Rabbit Polyclonal Anti-MCM6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MCM6
MCM6 Rabbit Polyclonal Antibody
TA327220

USD 275.00

3 Weeks

Rabbit anti-MCM6 Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MCM6
MCM6 Rabbit Polyclonal Antibody
TA590213

USD 409.00

In Stock

Rabbit Polyclonal MCM6 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
MCM6 (N-term) Rabbit Polyclonal Antibody
AP52640PU-N

USD 450.00

2 Weeks

MCM6 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 80-109 amino acids from the N-terminal region of Human MCM6.
MCM6 Rabbit Polyclonal Antibody
TA341685

USD 375.00

5 Days

Rabbit Polyclonal Anti-MCM6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCM6 antibody: synthetic peptide directed towards the C terminal of human MCM6. Synthetic peptide located within the following region: RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE
MCM6 Rabbit Polyclonal Antibody
TA341686

USD 310.00

5 Days

Rabbit Polyclonal Anti-MCM6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCM6 antibody: synthetic peptide directed towards the C terminal of human MCM6. Synthetic peptide located within the following region: RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE
MCM6 Rabbit Polyclonal Antibody
TA355846

USD 360.00

5 Days

MCM6 Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human MCM6
MCM6 Rabbit Polyclonal Antibody
TA362537

USD 360.00

5 Days

MCM6 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human MCM6
MCM6 Rabbit Polyclonal Antibody
TA363753

USD 360.00

5 Days

MCM6 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human MCM6
MCM6 Rabbit Polyclonal Antibody
TA364518

USD 380.00

4 Weeks

MCM6 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MCM6