Antibodies

Jump to Filters
View as table Download
MED25 (N-term) Rabbit Polyclonal Antibody
AP52653PU-N

USD 450.00

2 Weeks

MED25 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 119-148 amino acids from the N-terminal region of human MED25.
MED25 Rabbit Polyclonal Antibody
TA339763

USD 375.00

5 Days

Rabbit Polyclonal Anti-MED25 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MED25 antibody: synthetic peptide directed towards the N terminal of human MED25. Synthetic peptide located within the following region: EGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYV
MED25 Rabbit Polyclonal Antibody
TA339764

USD 375.00

5 Days

Rabbit Polyclonal Anti-MED25 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MED25 antibody is: synthetic peptide directed towards the C-terminal region of Human MED25. Synthetic peptide located within the following region: PPLLHPPPAQSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDI
MED25 Rabbit Polyclonal Antibody
TA378437

USD 220.00

3 Weeks

MED25 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-200 of human MED25 (NP_112235.2).
Modifications Unmodified