Germany
Japan
United Kingdom
China
METT10D (METTL16) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 451-480 amino acids from the C-terminal region of human MET10 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-METT10D Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-METT10D antibody: synthetic peptide directed towards the N terminal of human METT10D. Synthetic peptide located within the following region: LNGRVSLNFKDPEAVRALTCTLLREDFGLSIDIPLERLIPTVPLRLNYIH |
Rabbit Polyclonal Anti-METT10D Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-METT10D antibody: synthetic peptide directed towards the N terminal of human METT10D. Synthetic peptide located within the following region: ALSKSMHARNRYKDKPPDFAYLASKYPDFKQHVQINLNGRVSLNFKDPEA |
Rabbit Polyclonal Anti-METTL16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-METTL16 antibody is: synthetic peptide directed towards the middle region of Human METTL16. Synthetic peptide located within the following region: QGRTMRWALAWSFYDDVTVPSPPSKRRKLEKPRKPITFVVLASVMKELSL |
Carrier-free (BSA/glycerol-free) METT10D mouse monoclonal antibody,clone OTI5F10
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) METT10D mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
METTL16 Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 263-562 of human METTL16 (NP_076991.3). |
| Modifications | Unmodified |
USD 420.00
5 Days
USD 420.00
5 Days
METT10D mouse monoclonal antibody,clone OTI5F10
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
USD 420.00
5 Days
METT10D mouse monoclonal antibody,clone 5F10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
USD 420.00
5 Days
METT10D mouse monoclonal antibody,clone 5F10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | HRP |
METT10D mouse monoclonal antibody,clone OTI5F10
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
METT10D mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
METT10D mouse monoclonal antibody, clone OTI1A2 (formerly 1A2), Biotinylated
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
USD 420.00
4 Weeks
METT10D mouse monoclonal antibody, clone OTI1A2 (formerly 1A2), HRP conjugated
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | HRP |
METT10D mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- METTL16