Antibodies

Jump to Filters
View as table Download
MEX3A Rabbit Polyclonal Antibody
TA306671

USD 430.00

5 Days

Rabbit Polyclonal Rkhd4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rkhd4 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human Rkhd4.
MEX3A Rabbit Polyclonal Antibody
TA334108

USD 375.00

5 Days

Rabbit Polyclonal Anti-MEX3A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MEX3A Antibody is: synthetic peptide directed towards the N-terminal region of Human MEX3A. Synthetic peptide located within the following region: GEEPVFMVTGRREDVATARREIISAAEHFSMIRASRNKSGAAFGVAPALP