Germany
Japan
United Kingdom
China
MICA (+ MICB) mouse monoclonal antibody, clone 6D4, Low Endotoxin
| Applications | FC, FN, IHC, IP |
| Reactivities | Human |
Antibodies
View as table DownloadMICA mouse monoclonal antibody, clone B-N31, Azide Free
| Reactivities | Human |
Rabbit polyclonal MICA Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MICA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 68-97 amino acids from the Central region of human MICA. |
MICA (+ MICB) mouse monoclonal antibody, clone 6D4, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
Rabbit Polyclonal Anti-MICA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MICA antibody is: synthetic peptide directed towards the middle region of Human MICA. Synthetic peptide located within the following region: VQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLT |
Rabbit Polyclonal Anti-MICA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MICA antibody: synthetic peptide directed towards the N terminal of human MICA. Synthetic peptide located within the following region: LHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQ |
Rabbit Polyclonal Anti-MICA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MICA antibody: synthetic peptide directed towards the middle region of human MICA. Synthetic peptide located within the following region: LRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDT |
MICA rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MICA |
MICA Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 24-307 of human MICA (NP_000238.1). |
| Modifications | Unmodified |
MICA Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 24-307 of human MICA (NP_000238.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- MICA