Rabbit Polyclonal Anti-MICAL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MICAL2 Antibody is: synthetic peptide directed towards the N-terminal region of Human MICAL2. Synthetic peptide located within the following region: HRNFYSKLKSKVTTWKAKALWYKLDKRGSHKEYKRGKSCTNTKCLIVGGG |
MICAL2 (N-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 55-83aa) of human MICAL2. |
Rabbit Polyclonal Anti-MICAL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MICAL2 Antibody is: synthetic peptide directed towards the C-terminal region of Human MICAL2. Synthetic peptide located within the following region: GKFYCKPHFIHCKTNSKQRKRRAELKQQREEEATWQEQEAPRRDTPTESS |
MICAL2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MICAL2 |
Germany
Japan
United Kingdom
China