Antibodies

View as table Download

Rabbit Polyclonal Anti-C1orf151 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-C1orf151 Antibody: synthetic peptide directed towards the middle region of human C1orf151. Synthetic peptide located within the following region: IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ

Carrier-free (BSA/glycerol-free) C1orf151 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

C1orf151 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

C1orf151 mouse monoclonal antibody,clone 4H7, Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

C1orf151 mouse monoclonal antibody,clone 4H7, HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

C1orf151 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated