Antibodies

Jump to Filters
View as table Download
MKRN3 Rabbit Polyclonal Antibody
TA329564

USD 375.00

5 Days

Rabbit Polyclonal anti-Mkrn3 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Mkrn3 antibody is: synthetic peptide directed towards the middle region of Rat Mkrn3. Synthetic peptide located within the following region: ARGGQDSQPRASADRGPKMATHWEPPTQEVAEAPPTASSSSLPLIGSAAE
MKRN3 Rabbit Polyclonal Antibody
TA378550

USD 220.00

3 Weeks

MKRN3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human MKRN3 (NP_005655.1).
Modifications Unmodified