Rabbit Polyclonal Anti-MKX Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MKX antibody: synthetic peptide directed towards the middle region of human MKX. Synthetic peptide located within the following region: IKSENSVIKAGVRPESRASEDYVAPPKYKSSLLNRYLNDSLRHVMATNTT |
Rabbit Polyclonal anti-MKX antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MKX antibody: synthetic peptide directed towards the middle region of human MKX. Synthetic peptide located within the following region: KYKSSLLNRYLNDSLRHVMATNTTMMGKTRQRNHSGSFSSNEFEEELVSP |
Rabbit polyclonal anti-Mkx Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Mkx antibody is: synthetic peptide directed towards the C-terminal region of Mouse Mkx. Synthetic peptide located within the following region: SNEFEEELVSPSSSETEGTFVYRTDTPDIGSTKGDSAANRRGPSKDDTYW |
Carrier-free (BSA/glycerol-free) MKX mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MKX mouse monoclonal antibody, clone OTI6B9 (formerly 6B9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MKX Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
Mkx Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
MKX rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MKX |
MKX mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MKX mouse monoclonal antibody, clone OTI4H10 (formerly 4H10), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
MKX mouse monoclonal antibody, clone OTI4H10 (formerly 4H10), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
MKX mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
MKX mouse monoclonal antibody, clone OTI6B9 (formerly 6B9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MKX mouse monoclonal antibody, clone OTI6B9 (formerly 6B9), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
MKX mouse monoclonal antibody, clone OTI6B9 (formerly 6B9), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
MKX mouse monoclonal antibody, clone OTI6B9 (formerly 6B9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
