Rabbit Polyclonal Anti-MLLT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MLLT1 antibody: synthetic peptide directed towards the middle region of human MLLT1. Synthetic peptide located within the following region: EESNSEDEASFKSESAQSSPSNSSSSSDSSSDSDFEPSQNHSQGPLRSMV |
ENL / MLLT1 Rabbit Polyclonal (aa538-553) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | ENL / MLLT1 antibody was raised against synthetic peptide from human MLLT1. |
MLLT1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MLLT1. |
Germany
Japan
United Kingdom
China