Germany
Japan
United Kingdom
China
MLNR rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MLNR |
Antibodies
View as table Download
Rabbit polyclonal anti-MTLR antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MTLR. |
Rabbit Polyclonal Anti-MLNR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MLNR antibody is: synthetic peptide directed towards the C-terminal region of Human MLNR. Synthetic peptide located within the following region: ASINPILYNLISKKYRAAAFKLLLARKSRPRGFHRSRDTAGEVAGDTGGD |
Rabbit Polyclonal Anti-MLNR Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | MLNR/GPR38/Motilin Receptor antibody was raised against synthetic 16 amino acid peptide from C-terminal cytoplasmic domain of human MLNR. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Marmoset (81%). |
Rabbit Polyclonal Anti-MLNR Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MLNR |
Active filters
Target Symbol
- MLNR