Antibodies

Jump to Filters
View as table Download
MLX interacting protein (MLXIP) (N-term) Rabbit Polyclonal Antibody
AP52708PU-N

USD 450.00

2 Weeks

MLX interacting protein (MLXIP) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 79-108 amino acids from the N-terminal region of human MLXIP
MLX interacting protein (MLXIP) Rabbit Polyclonal Antibody
TA339476

USD 375.00

5 Days

Rabbit Polyclonal Anti-MLXIP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MLXIP antibody: synthetic peptide directed towards the middle region of human MLXIP. Synthetic peptide located within the following region: DEQGCEHTSRTEDPFIQPTDFGPSEPPLSVPQPFLPVFTMPLLSPSPAPP
MLX interacting protein (MLXIP) Rabbit Polyclonal Antibody
TA339477

USD 375.00

5 Days

Rabbit Polyclonal Anti-MLXIP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MLXIP antibody: synthetic peptide directed towards the C terminal of human MLXIP. Synthetic peptide located within the following region: ALSWLDQHCSLPILRPMVLSTLRQLSTSTSILTDPAQLPEQASKAVTRIG
MLX interacting protein (MLXIP) Rabbit Polyclonal Antibody
TA355023

USD 430.00

5 Days

Rabbit Polyclonal Anti-MLXIP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen MLXIP antibody was raised against a peptide corresponding to 19 amino acids near the amino terminus of human MLXIP.
MLX interacting protein (MLXIP) Rabbit Polyclonal Antibody
TA378572

USD 220.00

3 Weeks

MLXIP Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MLXIP (NP_055753.3).
Modifications Unmodified