Rabbit Polyclonal Anti-MMP26 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP26 antibody: synthetic peptide directed towards the C terminal of human MMP26. Synthetic peptide located within the following region: NLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQH |
Rabbit anti MMP-26 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-MMP26 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 243-261 amino acids of Human matrix metallopeptidase 26 |
MMP26 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MMP26 |
MMP26 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 90-261 of human MMP26 (NP_068573.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China