MMP-28 Rabbit Polyclonal (aa298-312) Antibody
Applications | IHC |
Reactivities | Human |
Immunogen | MMP28 antibody was raised against synthetic peptide from human MMP28. |
MMP-28 Rabbit Polyclonal (aa298-312) Antibody
Applications | IHC |
Reactivities | Human |
Immunogen | MMP28 antibody was raised against synthetic peptide from human MMP28. |
Rabbit Polyclonal Anti-MMP28 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MMP28 antibody is: synthetic peptide directed towards the N-terminal region of Human MMP28. Synthetic peptide located within the following region: LDAQPAERGGQELRKEAEAFLEKYGYLNEQVPKAPTSTRFSDAIRAFQWV |
Rabbit anti MMP-28 Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Anti-MMP28 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human matrix metallopeptidase 28 |
Anti-MMP28 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human matrix metallopeptidase 28 |
MMP28 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |