Rabbit polyclonal anti-MMP-7 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human MMP-7. |
Rabbit polyclonal anti-MMP-7 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human MMP-7. |
Rabbit anti-MMP7 Polyclonal Antibody
| Applications | ELISA, ICC/IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MMP7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP7 Antibody: A synthesized peptide derived from human MMP7 |
MMP7 (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide from C Terminus of human MMP7 - KLH conjugated |
Goat Polyclonal Antibody against MMP7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QKLYGKRSNSRKK, from the C Terminus of the protein sequence according to NP_002414.1. |
Rabbit Polyclonal MMP-7 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human MMP7 protein (between residues 250-300) [UniProt P09237] |
Rabbit Polyclonal Anti-MMP7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP7 antibody: synthetic peptide directed towards the C terminal of human MMP7. Synthetic peptide located within the following region: AATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGK |
Rabbit anti MMP-7 (Matrilysin) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human MMP-7. This sequence is identical among bovine and monkey. |
Carrier-free (glycerol/BSA-free) MMP7 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MMP7 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) MMP7 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MMP7 mouse monoclonal antibody, clone OTI4H8 (formerly 4H8)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-MMP7 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 5-100 amino acids of human matrix metallopeptidase 7 (matrilysin, uterine) |
MMP7 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
MMP7 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7), Biotinylated
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Biotin |
MMP7 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7), HRP conjugated
| Applications | IHC |
| Reactivities | Human |
| Conjugation | HRP |
MMP7 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
MMP7 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MMP7 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9), Biotinylated
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Biotin |
MMP7 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9), HRP conjugated
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
MMP7 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MMP7 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MMP7 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
MMP7 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
MMP7 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MMP7 mouse monoclonal antibody, clone OTI4H8 (formerly 4H8)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MMP7 mouse monoclonal antibody, clone OTI4H8 (formerly 4H8), Biotinylated
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Biotin |
MMP7 mouse monoclonal antibody, clone OTI4H8 (formerly 4H8), HRP conjugated
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
MMP7 mouse monoclonal antibody, clone OTI4H8 (formerly 4H8)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MMP7 mouse monoclonal antibody,clone UMAB168
| Applications | 10k-ChIP, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MMP7 mouse monoclonal antibody,clone UMAB168
| Applications | 10k-ChIP, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MMP7 mouse monoclonal antibody,clone UMAB168
| Applications | 10k-ChIP, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |