Antibodies

Jump to Filters
View as table Download
Methylmalonyl Coenzyme A mutase (MUT) Rabbit Polyclonal Antibody
TA335135

USD 375.00

5 Days

Rabbit polyclonal Anti-Mut Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Mut antibody is: synthetic peptide directed towards the N-terminal region of Mouse Mut. Synthetic peptide located within the following region: LAKKQLKGKNPEDLIWHTPEGISIKPLYSRADTLDLPEELPGVKPFTRGP
MMUT Rabbit Polyclonal Antibody
TA366696

USD 380.00

4 Weeks

MMUT rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MMUT