MNDA (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 26-53 amino acids from the N-terminal region of Human MNDA |
MNDA (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 26-53 amino acids from the N-terminal region of Human MNDA |
Rabbit polyclonal anti-MNDA antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MNDA. |
Rabbit Polyclonal Anti-MNDA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MNDA Antibody: synthetic peptide directed towards the C terminal of human MNDA. Synthetic peptide located within the following region: KCEKGDKLRLFCLQLRTVDRKLKLVCGSHSFIKVIKAKKNKEGPMNVN |
Carrier-free (BSA/glycerol-free) MNDA mouse monoclonal antibody, clone OTI4H6 (formerly 4H6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MNDA Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MNDA |
MNDA mouse monoclonal antibody, clone OTI4H6 (formerly 4H6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MNDA mouse monoclonal antibody, clone OTI4H6 (formerly 4H6), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
MNDA mouse monoclonal antibody, clone OTI4H6 (formerly 4H6), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
MNDA mouse monoclonal antibody, clone OTI4H6 (formerly 4H6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |