Antibodies

View as table Download

Rabbit Polyclonal Anti-MOBP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MOBP antibody is: synthetic peptide directed towards the N-terminal region of Human MOBP. Synthetic peptide located within the following region: SQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGC

MOBP Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic Peptide of human MOBP
Modifications Unmodified