Antibodies

Jump to Filters
View as table Download
MOGT1 (MOGAT1) (C-term) Rabbit Polyclonal Antibody
AP52722PU-N

USD 450.00

2 Weeks

MOGT1 (MOGAT1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 305-335 amino acids from the C-terminal region of Human MOGT1.
MOGT1 (MOGAT1) Rabbit Polyclonal Antibody
TA342082

USD 375.00

5 Days

Rabbit Polyclonal Anti-MOGAT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MOGAT1 antibody: synthetic peptide directed towards the C terminal of human MOGAT1. Synthetic peptide located within the following region: PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK