MOGT1 (MOGAT1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 305-335 amino acids from the C-terminal region of Human MOGT1. |
MOGT1 (MOGAT1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 305-335 amino acids from the C-terminal region of Human MOGT1. |
Rabbit Polyclonal Anti-MOGAT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MOGAT1 antibody: synthetic peptide directed towards the C terminal of human MOGAT1. Synthetic peptide located within the following region: PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK |