Antibodies

Jump to Filters
View as table Download
MOK protein kinase (MOK) Rabbit Polyclonal Antibody
TA314416

USD 345.00

In Stock

Rabbit polyclonal anti-MOK antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MOK.
MOK protein kinase (MOK) Rabbit Polyclonal Antibody
TA345115

USD 475.00

5 Days

Rabbit Polyclonal Anti-RAGE Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAGE antibody: synthetic peptide directed towards the middle region of human RAGE. Synthetic peptide located within the following region: TTNLSPQCLSLLHAMVAYDPDERIAAHQALQHPYFQEQRKTEKRALGSHR
MOK protein kinase (MOK) Rabbit Polyclonal Antibody
TA345116

USD 475.00

5 Days

Rabbit Polyclonal Anti-RAGE Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAGE antibody: synthetic peptide directed towards the N terminal of human RAGE. Synthetic peptide located within the following region: MKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKSGSLALICEL
MOK protein kinase (MOK) Rabbit Polyclonal Antibody
TA347785

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-MOK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MOK Antibody: A synthesized peptide derived from human MOK
MOK protein kinase (MOK) Rabbit Polyclonal Antibody
TA314417

USD 345.00

In Stock

Rabbit polyclonal anti-OR5AK3P antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR5AK3P.
MOK protein kinase (MOK) Rabbit Polyclonal Antibody
AP20575PU-N

USD 370.00

2 Weeks

MOK protein kinase (MOK) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide, corresponding to amino acids 150-205 of Human AGER / RAGE.
MOK protein kinase (MOK) Rabbit Polyclonal Antibody
TA336884

USD 430.00

5 Days

Rabbit Polyclonal RAGE Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A portion of amino acids 1-60 of human RAGE was used as the immunogen.
MOK protein kinase (MOK) (Center) Rabbit Polyclonal Antibody
AP17699PU-N

USD 450.00

2 Weeks

MOK protein kinase (MOK) (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the Center region of human RAGE
MOK protein kinase (MOK) Rabbit Polyclonal Antibody
TA337674

USD 375.00

5 Days

Rabbit Polyclonal Anti-PAFAH1B3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAFAH1B3 antibody: synthetic peptide directed towards the middle region of human PAFAH1B3. Synthetic peptide located within the following region: GHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVN
MOK protein kinase (MOK) Mouse Monoclonal Antibody [Clone ID: OTI7F4]
CF810801

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RAGE mouse monoclonal antibody,clone OTI7F4

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
MOK protein kinase (MOK) Rabbit Polyclonal Antibody
TA378599

USD 220.00

3 Weeks

MOK Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human MOK (NP_055041.1).
Modifications Unmodified