Rabbit Polyclonal Anti-MORN4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MORN4 antibody: synthetic peptide directed towards the middle region of human MORN4. Synthetic peptide located within the following region: FGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNLTA |
Rabbit Polyclonal Anti-GLMN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLMN antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LKRTRNNKWFTGPQLISLLDLVLFLPEGAETDLLQNSDRIMASLNLLRYL |
Germany
Japan
United Kingdom
China