Rabbit anti-MPG Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MPG |
Rabbit anti-MPG Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MPG |
Goat Polyclonal Antibody against MPG
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SVVDRVAEQDTQA, from the C Terminus of the protein sequence according to NP_002425.2; NP_001015052.1; NP_001015054.1. |
Rabbit Polyclonal Anti-MPG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MPG Antibody: synthetic peptide directed towards the middle region of human MPG. Synthetic peptide located within the following region: QRDLAQDEAVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGS |
Rabbit Polyclonal Anti-MPG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MPG Antibody: synthetic peptide directed towards the C terminal of human MPG. Synthetic peptide located within the following region: LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA |
Rabbit Polyclonal Anti-MPG Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MPG |
MPG Antibody - middle region
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of rat MPG |
MPG rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MPG |
MPG Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-293 of human MPG (NP_001015052.1). |
Modifications | Unmodified |