Rabbit Polyclonal Anti-MPPED2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MPPED2 antibody: synthetic peptide directed towards the N terminal of human MPPED2. Synthetic peptide located within the following region: RFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHT |
Rabbit Polyclonal Anti-MPPED2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MPPED2 antibody: synthetic peptide directed towards the C terminal of human MPPED2. Synthetic peptide located within the following region: PKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS |
Rabbit Polyclonal Anti-MPPED2 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mpped2 antibody is: synthetic peptide directed towards the N-terminal region of Rat Mpped2. Synthetic peptide located within the following region: MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYD |
MPPED2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Germany
Japan
United Kingdom
China
