Rabbit Polyclonal Anti-MPZL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MPZL1 antibody: synthetic peptide directed towards the middle region of human MPZL1. Synthetic peptide located within the following region: ISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVE |
MPZL1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MPZL1 |
MPZL1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-269 of human MPZL1 (NP_003944.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
