Rabbit Polyclonal Anti-MRFAP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MRFAP1 antibody is: synthetic peptide directed towards the C-terminal region of Human MRFAP1. Synthetic peptide located within the following region: KTQVEASEESALNHLQNPGDAAEGRAAKRCEKAEEKAKEIAKMAEMLVEL |
MRFAP1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MRFAP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human MRFAP1 (NP_150638.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China