Antibodies

Jump to Filters
View as table Download
MRGX1 (MRGPRX1) Rabbit Polyclonal Antibody
TA316277

USD 345.00

In Stock

Rabbit polyclonal anti-MRGX1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MRGX1.
MRGX1 (MRGPRX1) Rabbit Polyclonal Antibody
TA342781

USD 375.00

5 Days

Rabbit Polyclonal Anti-MRGPRX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MRGPRX1 antibody is: synthetic peptide directed towards the C-terminal region of Human MRGPRX1. Synthetic peptide located within the following region: FLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDASEVDEGGGQL
MRGX1 (MRGPRX1) Rabbit Polyclonal Antibody
TA351411

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-MRGPRX1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MRGPRX1
MRGPRX1 Rabbit Polyclonal Antibody
TA367140

USD 380.00

4 Weeks

MRGPRX1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MRGPRX1
MRGX1 (MRGPRX1) Rabbit Polyclonal Antibody
TA378631

USD 220.00

3 Weeks

MRGPRX1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 263-322 of human MRGPRX1 (NP_671732.3).
Modifications Unmodified