Antibodies

View as table Download

MRGPRX2 / MRGX2 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen MRGPRX2 / MRGX2 antibody was raised against synthetic 16 amino acid peptide from 3rd extracellular domain of human MRGPRX2 / MRGX2. Percent identity with other species by BLAST analysis: Human (100%); Chimpanzee, Gorilla, Monkey (94%); Orangutan (88%); Gibbon (81%).

GPCR MRGX2 (MRGPRX2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 286-316aa) of human MRGPRX2.

MRGPRX2 / MRGX2 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Chimpanzee, Human, Gorilla
Conjugation Unconjugated
Immunogen MRGPRX2 / MRGX2 antibody was raised against synthetic 16 amino acid peptide from C-terminal cytoplasmic domain of human MRGPRX2 / MRGX2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla (100%); Orangutan (94%); Gibbon, Monkey (88%).

Rabbit Polyclonal Anti-MRGPRX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MRGPRX2 antibody: synthetic peptide directed towards the middle region of human MRGPRX2. Synthetic peptide located within the following region: VCVLLWALSLLLSILEGKFCGFLFSDGDSGWCQTFDFITAAWLIFLFMVL