MRGPRX2 / MRGX2 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | MRGPRX2 / MRGX2 antibody was raised against synthetic 16 amino acid peptide from 3rd extracellular domain of human MRGPRX2 / MRGX2. Percent identity with other species by BLAST analysis: Human (100%); Chimpanzee, Gorilla, Monkey (94%); Orangutan (88%); Gibbon (81%). |
GPCR MRGX2 (MRGPRX2) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 286-316aa) of human MRGPRX2. |
MRGPRX2 / MRGX2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Human, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | MRGPRX2 / MRGX2 antibody was raised against synthetic 16 amino acid peptide from C-terminal cytoplasmic domain of human MRGPRX2 / MRGX2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla (100%); Orangutan (94%); Gibbon, Monkey (88%). |
Rabbit Polyclonal Anti-MRGPRX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MRGPRX2 antibody: synthetic peptide directed towards the middle region of human MRGPRX2. Synthetic peptide located within the following region: VCVLLWALSLLLSILEGKFCGFLFSDGDSGWCQTFDFITAAWLIFLFMVL |
Germany
Japan
United Kingdom
China
