Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-MRPL24 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MRPL24 antibody: synthetic peptide directed towards the N terminal of human MRPL24. Synthetic peptide located within the following region: RRRPVVVEPISDEDWYLFCGDTVEILEGKDAGKQGKVVQVIRQRNWVVVG |
Rabbit Polyclonal Anti-mrpl24 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-mrpl24 antibody is: synthetic peptide directed towards the C-terminal region of Rat mrpl24. Synthetic peptide located within the following region: GIVPETWTDGPKDTSVEDALERTYVPRLKTLEEDVMEAMGIQETRRFKKI |
Carrier-free (BSA/glycerol-free) MRPL24 mouse monoclonal antibody,clone OTI1B4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MRPL24 mouse monoclonal antibody,clone OTI1A10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MRPL24 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-216 of human MRPL24 (NP_078816.2). |
| Modifications | Unmodified |
MRPL24 mouse monoclonal antibody,clone OTI1B4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MRPL24 mouse monoclonal antibody,clone OTI1B4, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
MRPL24 mouse monoclonal antibody,clone OTI1B4, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
MRPL24 mouse monoclonal antibody,clone OTI1B4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MRPL24 mouse monoclonal antibody,clone OTI1A10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MRPL24 mouse monoclonal antibody,clone OTI1A10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
MRPL24 mouse monoclonal antibody,clone OTI1A10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
MRPL24 mouse monoclonal antibody,clone OTI1A10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- MRPL24