Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-MRPL39 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MRPL39 antibody: synthetic peptide directed towards the N terminal of human MRPL39. Synthetic peptide located within the following region: TELTEMRNDLFNKEKARQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNIST |
Rabbit Polyclonal Anti-MRPL39 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MRPL39 |
MRPL39 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MRPL39 |
MRPL39 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 39-338 of human MRPL39 (NP_059142.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- MRPL39