Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-MRPS25 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MRPS25. |
MRPS25 mouse monoclonal antibody, clone AT38E7, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
MRPS25 mouse monoclonal antibody, clone AT38E7, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
MRPS25 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MRPS25 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MRPS25 antibody is: synthetic peptide directed towards the C-terminal region of Human MRPS25. Synthetic peptide located within the following region: YKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKIL |
Rabbit Polyclonal Anti-MRPS25 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MRPS25 antibody is: synthetic peptide directed towards the C-terminal region of Human MRPS25. Synthetic peptide located within the following region: SHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD |
MRPS25 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MRPS25. |
Active filters
Target Symbol
- MRPS25