Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 20 of 20 results

(reset)

MSH2 Rabbit Polyclonal Antibody

TA372365

USD 380.00

4 Weeks

MSH2 rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human MSH2

1 / 3

2 / 3

3 / 3

Previous Next

MSH2 Rabbit Polyclonal Antibody

TA346018

USD 475.00

5 Days

Rabbit Polyclonal Anti-MSH2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-MSH2 antibody: synthetic peptide directed towards the N terminal of human MSH2. Synthetic peptide located within the following region: GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG

1 / 2

2 / 2

Previous Next

MSH2 Rabbit Polyclonal Antibody

TA326937

USD 275.00

3 Weeks

MSH2 Rabbit Polyclonal Antibody

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human MSH2

MSH2 Rabbit Polyclonal Antibody

TA346017

USD 410.00

5 Days

Rabbit Polyclonal Anti-MSH2 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-MSH2 antibody: synthetic peptide directed towards the N terminal of human MSH2. Synthetic peptide located within the following region: KMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECV

MSH2 Mouse Monoclonal Antibody [Clone ID: 4G5-E11-D9]

TA347005

USD 380.00

4 Weeks

Mouse Monoclonal MSH2 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated

MSH2 Rabbit Polyclonal Antibody

TA324411

USD 450.00

5 Days

Rabbit polyclonal MSH2 Antibody (Center)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This MSH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 637-665 amino acids from the Central region of human MSH2.

1 / 3

2 / 3

3 / 3

Previous Next

MSH2 Rabbit Polyclonal Antibody

TA313355

USD 345.00

4 Weeks

Rabbit polyclonal anti-MSH2 antibody

Applications	IF, IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human MSH2.

1 / 2

2 / 2

Previous Next

MSH2 Mouse Monoclonal Antibody [Clone ID: 1184CT1.3.2]

TA328162

USD 450.00

5 Days

Mouse monoclonal anti-MSH2 antibody (Center)

Applications	WB
Reactivities	Human
Conjugation	Unconjugated

MSH2 Mouse Monoclonal Antibody [Clone ID: OTI10F7]

CF814210

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) MSH2 mouse monoclonal antibody, clone OTI10F7

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

MSH2 Mouse Monoclonal Antibody [Clone ID: G219-1129]

TA327701

USD 715.00

5 Days

Mouse Monoclonal MSH2 Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated

MSH2 Mouse Monoclonal Antibody [Clone ID: 79H11]

TA355274

USD 1,530.00

3 Weeks

Mismatch Repair Protein (MSH2) Mouse Monoclonal Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated

MSH2 Rabbit Polyclonal Antibody

TA368134

USD 380.00

4 Weeks

MSH2 rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human MSH2

MSH2 Rabbit Monoclonal Antibody [Clone ID: R03-1F3]

TA384803

USD 380.00

4 Weeks

MSH2 Rabbit monoclonal Antibody

Applications	IP, WB
Reactivities	Human
Conjugation	Unconjugated

MSH2 Mouse Monoclonal Antibody [Clone ID: OTI10F7]

TA814210

USD 379.00

In Stock

MSH2 mouse monoclonal antibody, clone OTI10F7

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

MSH2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10F7]

TA814210AM

USD 420.00

2 Weeks

MSH2 mouse monoclonal antibody, clone OTI10F7, Biotinylated

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

MSH2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10F7]

TA814210BM

USD 420.00

2 Weeks

MSH2 mouse monoclonal antibody, clone OTI10F7, HRP conjugated

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

MSH2 Mouse Monoclonal Antibody [Clone ID: OTI10F7]

TA814210S

USD 159.00

2 Weeks

MSH2 mouse monoclonal antibody, clone OTI10F7

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

MSH2 Mouse Monoclonal Antibody [Clone ID: UMAB259]

UM800149

USD 468.00

In Stock

MSH2 mouse monoclonal antibody,clone UMAB259

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

MSH2 Mouse Monoclonal Antibody [Clone ID: UMAB259]

UM800149CF

USD 528.00

In Stock

Carrier-free (BSA/glycerol-free) MSH2 mouse monoclonal antibody,clone UMAB259

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

MSH2 Mouse Monoclonal Antibody [Clone ID: UMAB259]

UM870149

USD 180.00

In Stock

MSH2 mouse monoclonal antibody,clone UMAB259

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

1 - 20 of 20 results