Rabbit Polyclonal Anti-MSRA Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MSRA antibody is: synthetic peptide directed towards the middle region of Human MSRA. Synthetic peptide located within the following region: VYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVF |
Rabbit Polyclonal Anti-MSRA Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSRA antibody: synthetic peptide directed towards the middle region of human MSRA. Synthetic peptide located within the following region: YQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVS |
Methionine Sulfoxide Reductase A (MSRA) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Recombinant human protein purified from E. coli |
MSRA Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse MSRA |
MSRA Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 24-235 of human MSRA (NP_036463.1). |
| Modifications | Unmodified |
MSRA Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 24-235 of human MSRA (NP_036463.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China