Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal MSX1 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This MSX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 111-138 amino acids from the Central region of human MSX1. |
Rabbit Polyclonal anti-MSX1 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSX1 antibody: synthetic peptide directed towards the middle region of human MSX1. Synthetic peptide located within the following region: SLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRF |
Goat Anti-MSX1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence TSLPLGVKVEDS-C, from the N Terminus of the protein sequence according to NP_002439.1. |
Rabbit Polyclonal Anti-MSX1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSX1 antibody: synthetic peptide directed towards the N terminal of mouse MSX1. Synthetic peptide located within the following region: KPGAKESVLVASEGAQAAGGSVQHLGTRPGSLGAPDAPSSPRPLGHFSVG |
Active filters
Target Symbol
- MSX1