Rabbit Polyclonal Anti-MTHFSD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTHFSD antibody: synthetic peptide directed towards the N terminal of human MTHFSD. Synthetic peptide located within the following region: EVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITPPPGATKDIL |
Rabbit Polyclonal Anti-MTHFSD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTHFSD antibody: synthetic peptide directed towards the N terminal of human MTHFSD. Synthetic peptide located within the following region: MEPRAGVSKQDIREQIWGYMESQNLADFPRPVHHRIPNFKGSYLACQNIK |
MTHFSD Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-383 of human MTHFSD (NP_001152849.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
