Antibodies

Jump to Filters
View as table Download
MTMR1 Rabbit Polyclonal Antibody
TA346366

USD 410.00

5 Days

Rabbit Polyclonal Anti-MTMR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTMR1 antibody: synthetic peptide directed towards the C terminal of human MTMR1. Synthetic peptide located within the following region: KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY
MTMR1 Rabbit Polyclonal Antibody
TA378756

USD 220.00

3 Weeks

MTMR1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of Human MTMR1.
Modifications Unmodified