Rabbit Polyclonal Anti-MTUS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTUS1 antibody: synthetic peptide directed towards the middle region of human MTUS1. Synthetic peptide located within the following region: KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR |
Rabbit Polyclonal Anti-MTUS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTUS1 antibody: synthetic peptide directed towards the N terminal of human MTUS1. Synthetic peptide located within the following region: QLLACGNTKFEALTVVIQHLLSEREEALKQHKTLSQELVNLRGELVTAST |
Rabbit Polyclonal Anti-MTUS1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MTUS1 |
MTUS1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MTUS1 |
MTUS1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 207-436 of human MTUS1 (NP_065800.1). |
| Modifications | Unmodified |
MTUS1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 207-436 of human MTUS1 (NP_065800.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
