Antibodies

Jump to Filters
View as table Download
MTX2 (C-term) Rabbit Polyclonal Antibody
AP52772PU-N

USD 450.00

2 Weeks

MTX2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 235-265aa) of human Metaxin-2.
MTX2 Rabbit Polyclonal Antibody
TA339944

USD 375.00

5 Days

Rabbit Polyclonal Anti-MTX2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTX2 antibody: synthetic peptide directed towards the N terminal of human MTX2. Synthetic peptide located within the following region: YIAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCRA
MTX2 Mouse Monoclonal Antibody [Clone ID: OTI2E9]
CF811991

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MTX2 mouse monoclonal antibody,clone OTI2E9

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
MTX2 Rabbit Polyclonal Antibody
TA378796

USD 220.00

3 Weeks

MTX2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-263 of human MTX2 (NP_006545.1).
Modifications Unmodified
MTX2 Mouse Monoclonal Antibody [Clone ID: OTI2E9]
TA811991

USD 379.00

In Stock

MTX2 mouse monoclonal antibody,clone OTI2E9

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
MTX2 Mouse Monoclonal Antibody [Clone ID: OTI2E9]
TA811991S

USD 159.00

2 Days

MTX2 mouse monoclonal antibody,clone OTI2E9

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated