Antibodies

View as table Download

Rabbit polyclonal Mevalonate Kinase antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Mevalonate Kinase.

Rabbit anti-MVK Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MVK

MVK rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal Anti-MVK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MVK antibody: synthetic peptide directed towards the N terminal of human MVK. Synthetic peptide located within the following region: LAVLAFLYLYLSICRKQRALPSLDIVVWSELPPGAGLGSSAAYSVCLAAA

Rabbit polyclonal Anti-MVK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MVK antibody: synthetic peptide directed towards the middle region of human MVK. Synthetic peptide located within the following region: KEDLELINKWAFQGERMIHGNPSGVDNAVSTWGGALRYHQGKISSLKRSP

Carrier-free (BSA/glycerol-free) MVK mouse monoclonal antibody, clone OTI 1D7 (formerly 1D7)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-MVK Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MVK

MVK rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MVK

MVK mouse monoclonal antibody, clone OTI 1D7 (formerly 1D7)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

MVK mouse monoclonal antibody, clone OTI 1D7 (formerly 1D7)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated