Antibodies

Jump to Filters
View as table Download
MVK Rabbit Polyclonal Antibody
TA313341

USD 345.00

In Stock

Rabbit polyclonal Mevalonate Kinase antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Mevalonate Kinase.
MVK Rabbit Polyclonal Antibody
TA332632

USD 275.00

3 Weeks

Rabbit anti-MVK Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MVK
MVK Rabbit Polyclonal Antibody
AP20432PU-N

USD 407.00

2 Weeks

MVK rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
MVK Rabbit Polyclonal Antibody
TA335150

USD 375.00

5 Days

Rabbit polyclonal Anti-MVK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MVK antibody: synthetic peptide directed towards the N terminal of human MVK. Synthetic peptide located within the following region: LAVLAFLYLYLSICRKQRALPSLDIVVWSELPPGAGLGSSAAYSVCLAAA
MVK Rabbit Polyclonal Antibody
TA335151

USD 375.00

5 Days

Rabbit polyclonal Anti-MVK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MVK antibody: synthetic peptide directed towards the middle region of human MVK. Synthetic peptide located within the following region: KEDLELINKWAFQGERMIHGNPSGVDNAVSTWGGALRYHQGKISSLKRSP
MVK Mouse Monoclonal Antibody [Clone ID: OTI 1D7]
CF502934

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MVK mouse monoclonal antibody, clone OTI 1D7 (formerly 1D7)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
MVK Rabbit Polyclonal Antibody
TA350193

USD 345.00

In Stock

Rabbit Polyclonal Anti-MVK Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MVK
MVK Rabbit Polyclonal Antibody
TA369222

USD 380.00

4 Weeks

MVK rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MVK
MVK Mouse Monoclonal Antibody [Clone ID: OTI 1D7]
TA502934

USD 379.00

In Stock

MVK mouse monoclonal antibody, clone OTI 1D7 (formerly 1D7)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
MVK Mouse Monoclonal Antibody [Clone ID: OTI 1D7]
TA502934S

USD 159.00

2 Days

MVK mouse monoclonal antibody, clone OTI 1D7 (formerly 1D7)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated