Antibodies

Jump to Filters
View as table Download
MX1 Rabbit Polyclonal Antibody
TA308496

USD 415.00

In Stock

Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591)
MX1 Rabbit Polyclonal Antibody
TA308007

USD 415.00

In Stock

Rabbit polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 276 of MX1 (Uniprot ID#P20591)
MX1 (Center) Rabbit Polyclonal Antibody
AP52780PU-N

USD 450.00

2 Weeks

MX1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the central region (between 408-437aa) of human MX1
MX1 Rabbit Polyclonal Antibody
TA339254

USD 375.00

5 Days

Rabbit Polyclonal Anti-MX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MX1 antibody: synthetic peptide directed towards the C terminal of human MX1. Synthetic peptide located within the following region: KAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQFPG
MX1 Mouse Monoclonal Antibody [Clone ID: OTI2G12]
CF500357

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) MX1 mouse monoclonal antibody, clone OTI2G12 (formerly 2G12)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
MX1 Mouse Monoclonal Antibody [Clone ID: OTI2E7]
CF812749

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MX1 mouse monoclonal antibody,clone OTI2E7

Applications WB
Reactivities Human
Conjugation Unconjugated
MX1 Rabbit Polyclonal Antibody
TA350077

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-MX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human MX1
MX1 Mouse Monoclonal Antibody [Clone ID: OTI2G12]
TA500357

USD 379.00

In Stock

MX1 mouse monoclonal antibody, clone OTI2G12 (formerly 2G12)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
MX1 Mouse Monoclonal Antibody [Clone ID: OTI2G12]
TA500357S

USD 159.00

In Stock

MX1 mouse monoclonal antibody, clone OTI2G12 (formerly 2G12)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
MX1 Mouse Monoclonal Antibody [Clone ID: OTI2E7]
TA812749

USD 379.00

In Stock

MX1 mouse monoclonal antibody,clone OTI2E7

Applications WB
Reactivities Human
Conjugation Unconjugated
MX1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E7]
TA812749BM

USD 420.00

4 Weeks

MX1 mouse monoclonal antibody,clone OTI2E7, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP
MX1 Mouse Monoclonal Antibody [Clone ID: OTI2E7]
TA812749S

USD 159.00

2 Days

MX1 mouse monoclonal antibody,clone OTI2E7

Applications WB
Reactivities Human
Conjugation Unconjugated