Rabbit Polyclonal Anti-MXD1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MXD1 Antibody: synthetic peptide directed towards the N terminal of human MXD1. Synthetic peptide located within the following region: MAAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDALKRRNKS |
Rabbit Polyclonal Anti-Mxd1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for anti-Mxd1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TQLKDTECTPVGGPLSLEQVQNGNDTPTQVEYQEAPETQVKARHKEGANQ |
Mxd1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China