Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Myb Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Myb |
Rabbit polyclonal Myb (Phospho-Ser532) antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Myb around the phosphorylation site of serine 532 (V-E-SP-P-T). |
| Modifications | Phospho-specific |
Rabbit polyclonal Myb (Ab-532) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Myb around the phosphorylation site of serine 532 (V-E-SP-P-T). |
Rabbit Polyclonal Phospho-Myb (Ser532) Antibody (Phospho-specific)
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Myb around the phosphorylation site of Serine 532 |
| Modifications | Phospho-specific |
c-Myb (MYB) (557-569) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat |
| Immunogen | Peptide corresponding to internal region of Human c-Myb |
Rabbit Polyclonal Anti-MYB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYB antibody: synthetic peptide directed towards the N terminal of human MYB. Synthetic peptide located within the following region: YDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTD |
Rabbit Polyclonal Anti-MYB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MYB antibody is: synthetic peptide directed towards the C-terminal region of Human MYB. Synthetic peptide located within the following region: AFTVPKNRSLASPLQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSART |
Rabbit Polyclonal anti-MYB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MYB antibody is: synthetic peptide directed towards the C-terminal region of Human MYB. Synthetic peptide located within the following region: VPKNRSLASPLQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSARTLVM |
Mouse anti c-myb / v-myb Monoclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MYB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MYB |
Phospho-c Myb (Ser11) Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Myb (Phosphorylated) |
Active filters
Target Symbol
- MYB