Germany
Japan
United Kingdom
China
Rabbit polyclonal MYF5 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from inetrnal of human MYF5. |
Antibodies
View as table Download
MYF5 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
MYF5 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 6-36aa) of human Myogenic factor 5 (MYF5) |
Goat Polyclonal Antibody against MYF5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence PECNSPVWSRKSST, from the internal region of the protein sequence according to NP_005584.1. |
Rabbit Polyclonal anti-MYF5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYF5 antibody: synthetic peptide directed towards the C terminal of human MYF5. Synthetic peptide located within the following region: LSSLDCLSNIVDRITSSEQPGLPLQDLASLSPVASTDSQPATPGASSSRL |
Rabbit Polyclonal anti-Myf5 Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for Anti-Myf5 antibody is: synthetic peptide directed towards the middle region of Rat Myf5. Synthetic peptide located within the following region: DEEHVRAPTGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVN |
Rabbit Polyclonal Anti-MYF5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYF5 antibody: synthetic peptide directed towards the N terminal of human MYF5. Synthetic peptide located within the following region: ACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPK |
Rabbit Polyclonal Anti-MYF5 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MYF5 |
MYF5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-255 of human MYF5 (NP_005584.2). |
Active filters
Target Symbol
- MYF5